Member Login

Not a member yet? Sign Up!

НОВЫЕ ИГРЫ
ПОПУЛЯРНЫЕ ИГРЫ
ЛУЧШИЕ ИГРЫ
LOGIN
CLOSE
ДОСКА ПОЧЕТА ( Гордость game2ok ) (обновляется первого числа каждого месяца)

ROBOTS INITIATE WORK SEQUENCE (ИССЛЕДОВАНИЕ РОБОТАМИ)

Поиск игр по похожим темам по всему сайту :

роботы

SIZE +/-:
FullScreen FullScreen 2
Для выхода из полноэкранного режима, нажмите ESC, или квадратик внизу по середине
Описание игры

Реалтайм стратегия, в которой вы управляете роботами, которые создают базу на необитаемой планете.

Оцените игру:
Нажмите на значок
8
9
-1
Это онлайн игра из категории В реальном времени в которую вы можете играть бесплатно на game2ok. В нее уже играли 2,750 раз, игра была добавлена 5 2014
Отзывы о игре ROBOTS INITIATE WORK SEQUENCE (ИССЛЕДОВАНИЕ РОБОТАМИ)

Отзывы (4)
avatar
Анонимный игрок говорит...
блять чуть не абасрался looolmhumhuomg вот как била
26 February 2017 12.17
avatar
Анонимный игрок говорит...
opekaocrymanulmeemhuneponinocommentsnotchmadiihuhharupekahappycrycrycrazybutthawesomeaangryimageimagesadimageepekakawaiomgmini-happygloryfacepalmalonedobrefuuuufyeahgrumpymegustamvpno-okaynotbadokayslowpokewhyapochaibinbmcapimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimageimage
26 February 2017 12.16
avatar
Анонимный игрок говорит...
image
10 January 2017 13.43
avatar
Анонимный игрок говорит...
kawai
31 July 2016 15.42
Написать отзыв
* Обязательные поля
Bold Italic Underline Strike Superscript Subscript Code PHP Quote Line Bullet Numeric Link Email Image Video
 
Похожие игры
Яндекс.Метрика